PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0605s0071.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 328aa    MW: 36862.4 Da    PI: 4.6633
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0605s0071.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.79.6e-092703042155
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          k +yp++ ++  LA+ +gL+++q+ +WF N+R ++
  Cagra.0605s0071.1.p 270 KWPYPTEGDKIALADATGLDQKQINNWFINQRKRH 304
                          669*****************************885 PP

2ELK30.11.1e-10224245122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          +LK++LlrK++++++sLk EFs
  Cagra.0605s0071.1.p 224 DLKDRLLRKFGSRISSLKLEFS 245
                          69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.4E-2283127IPR005540KNOX1
PfamPF037901.4E-2185126IPR005540KNOX1
SMARTSM012564.4E-25134185IPR005541KNOX2
PfamPF037912.7E-23138184IPR005541KNOX2
SMARTSM011886.3E-5224245IPR005539ELK domain
PROSITE profilePS512139.83224244IPR005539ELK domain
PfamPF037892.6E-7224245IPR005539ELK domain
PROSITE profilePS5007112.341244307IPR001356Homeobox domain
SuperFamilySSF466892.82E-19245319IPR009057Homeodomain-like
SMARTSM003891.9E-12246311IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-27249308IPR009057Homeodomain-like
CDDcd000861.03E-11253308No hitNo description
PfamPF059204.8E-17264303IPR008422Homeobox KN domain
PROSITE patternPS000270282305IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDGMYNFHSA GDYSDKAVLM MSPESLMFPS DYQALLCSSA GENRVSDVFG SDELLSAAAS  60
ALSSEAASIA PEIRRNDDNV SLSVIKSKIA SHPSYPRLLQ AYIDCQKVGA PPEIACLLEE  120
IQRESDVYKR DVVPLSCYGA DTELDEFMET YCDILVKYKS DLARPFDEAT SFLNKIEMQL  180
RNLCTGVDSA RNVSEDGAIS SDEELSGGDH EVAEDGRQRC EDRDLKDRLL RKFGSRISSL  240
KLEFSKKKKK GKLPREARQA LLDWWNLHYK WPYPTEGDKI ALADATGLDQ KQINNWFINQ  300
RKRHWKPSEN MPFAMMDDSG GSFFTEE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0029300.0BT002930.1 Arabidopsis thaliana clone RAFL14-89-I21 (R20256) putative homeodomain transcription factor KNAT6 (At1g23380) mRNA, complete cds.
GenBankBT0043700.0BT004370.1 Arabidopsis thaliana clone U20256 putative homeodomain transcription factor KNAT6 (At1g23380) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850951.20.0homeobox protein knotted-1-like 6
SwissprotQ84JS60.0KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLD7KNF20.0D7KNF2_ARALL; Putative uncharacterized protein
STRINGAT1G23380.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.10.0KNOTTED1-like homeobox gene 6